PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.10G062800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB_related
Protein Properties Length: 202aa    MW: 23321.1 Da    PI: 6.5217
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.10G062800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-14109153347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ +++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
  Manes.10G062800.1.p 109 PWTEEEHRKFLFGLEKFGKGDWRSISRNVVVTRTPAQVASHAQKY 153
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.891162IPR001005SANT/Myb domain
SuperFamilySSF466898.23E-91367IPR009057Homeodomain-like
PROSITE profilePS500904.8791560IPR017877Myb-like domain
PROSITE profilePS5129419.301102158IPR017930Myb domain
SuperFamilySSF466893.8E-17104159IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-17105157IPR006447Myb domain, plants
SMARTSM007174.8E-11106156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-11106152IPR009057Homeodomain-like
CDDcd001672.27E-9109154No hitNo description
PfamPF002492.8E-12109153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MHRLTLPSSS INSCWNRYDD KLFEEALIRF PEELPDRWQE IAAYTGKSVQ EVTEYYEYLA  60
HDVFEIDSGR IELPIYSDDL VDSTMAALDQ ISFGNKTKLR EAERKKGTPW TEEEHRKFLF  120
GLEKFGKGDW RSISRNVVVT RTPAQVASHA QKYFLRQNSV RKERKRSSIH DITIVDNNSV  180
ALPADQNWIP SPGAPFHQPS F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065468.13e-94PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A067L5I94e-94A0A067L5I9_JATCU; Uncharacterized protein
STRINGGLYMA20G24600.13e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-75MYB family protein